HLA-C MaxPab rabbit polyclonal antibody (D01) Ver mas grande

HLA-C MaxPab rabbit polyclonal antibody (D01)

AB-H00003107-D01

Producto nuevo

HLA-C MaxPab rabbit polyclonal antibody (D01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 uL
Gene Name HLA-C
Gene Alias D6S204|FLJ27082|HLA-Cw|HLA-Cw12|HLA-JY3|HLC-C|PSORS1
Gene Description major histocompatibility complex, class I, C
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HLA-C (AAH02463.1, 1 a.a. ~ 366 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3107

Más información

Rabbit polyclonal antibody raised against a full-length human HLA-C protein.

Consulta sobre un producto

HLA-C MaxPab rabbit polyclonal antibody (D01)

HLA-C MaxPab rabbit polyclonal antibody (D01)