HLA-C MaxPab rabbit polyclonal antibody (D01) View larger

Rabbit polyclonal antibody raised against a full-length human HLA-C protein.

AB-H00003107-D01

New product

HLA-C MaxPab rabbit polyclonal antibody (D01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 uL
Gene Name HLA-C
Gene Alias D6S204|FLJ27082|HLA-Cw|HLA-Cw12|HLA-JY3|HLC-C|PSORS1
Gene Description major histocompatibility complex, class I, C
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HLA-C (AAH02463.1, 1 a.a. ~ 366 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3107

More info

Rabbit polyclonal antibody raised against a full-length human HLA-C protein.

Enviar uma mensagem

Rabbit polyclonal antibody raised against a full-length human HLA-C protein.

Rabbit polyclonal antibody raised against a full-length human HLA-C protein.