Ver mas grande
GTF2H2 purified MaxPab mouse polyclonal antibody (B01P)
AB-H00002966-B01P
Producto nuevo
GTF2H2 purified MaxPab mouse polyclonal antibody (B01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | GTF2H2 |
| Gene Alias | BTF2|BTF2P44|MGC102806|T-BTF2P44|TFIIH |
| Gene Description | general transcription factor IIH, polypeptide 2, 44kDa |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Tr,IF |
| Immunogen Prot. Seq | MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFP |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | GTF2H2 (NP_001506.1, 1 a.a. ~ 395 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 2966 |
Más información
Mouse polyclonal antibody raised against a full-length human GTF2H2 protein.