GTF2H2 purified MaxPab mouse polyclonal antibody (B01P)
  • GTF2H2 purified MaxPab mouse polyclonal antibody (B01P)

GTF2H2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002966-B01P
GTF2H2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GTF2H2 protein.
Información adicional
Size 50 ug
Gene Name GTF2H2
Gene Alias BTF2|BTF2P44|MGC102806|T-BTF2P44|TFIIH
Gene Description general transcription factor IIH, polypeptide 2, 44kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GTF2H2 (NP_001506.1, 1 a.a. ~ 395 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2966

Enviar uma mensagem


GTF2H2 purified MaxPab mouse polyclonal antibody (B01P)

GTF2H2 purified MaxPab mouse polyclonal antibody (B01P)