GRIN2B monoclonal antibody (M01), clone 2G5
  • GRIN2B monoclonal antibody (M01), clone 2G5

GRIN2B monoclonal antibody (M01), clone 2G5

Ref: AB-H00002904-M01
GRIN2B monoclonal antibody (M01), clone 2G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GRIN2B.
Información adicional
Size 100 ug
Gene Name GRIN2B
Gene Alias MGC142178|MGC142180|NMDAR2B|NR2B|hNR3
Gene Description glutamate receptor, ionotropic, N-methyl D-aspartate 2B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq HGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRIN2B (NP_000825, 127 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2904
Clone Number 2G5
Iso type IgG2a Kappa

Enviar un mensaje


GRIN2B monoclonal antibody (M01), clone 2G5

GRIN2B monoclonal antibody (M01), clone 2G5