View larger
Mouse monoclonal antibody raised against a partial recombinant GRIN2B.
AB-H00002904-M01
New product
GRIN2B monoclonal antibody (M01), clone 2G5
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | GRIN2B |
| Gene Alias | MGC142178|MGC142180|NMDAR2B|NR2B|hNR3 |
| Gene Description | glutamate receptor, ionotropic, N-methyl D-aspartate 2B |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA,PLA-Ce |
| Immunogen Prot. Seq | HGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEE |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | GRIN2B (NP_000825, 127 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 2904 |
| Clone Number | 2G5 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant GRIN2B.