GFRA1 monoclonal antibody (M08), clone 4G3 Ver mas grande

GFRA1 monoclonal antibody (M08), clone 4G3

AB-H00002674-M08

Producto nuevo

GFRA1 monoclonal antibody (M08), clone 4G3

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name GFRA1
Gene Alias GDNFR|GDNFRA|GFR-ALPHA-1|MGC23045|RET1L|RETL1|TRNR1
Gene Description GDNF family receptor alpha 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,IF
Immunogen Prot. Seq ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GFRA1 (NP_005255, 32 a.a. ~ 119 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2674
Clone Number 4G3
Iso type IgG2b Kappa

Más información

Mouse monoclonal antibody raised against a full length recombinant GFRA1.

Consulta sobre un producto

GFRA1 monoclonal antibody (M08), clone 4G3

GFRA1 monoclonal antibody (M08), clone 4G3