GFRA1 monoclonal antibody (M08), clone 4G3 View larger

Mouse monoclonal antibody raised against a full length recombinant GFRA1.

AB-H00002674-M08

New product

GFRA1 monoclonal antibody (M08), clone 4G3

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name GFRA1
Gene Alias GDNFR|GDNFRA|GFR-ALPHA-1|MGC23045|RET1L|RETL1|TRNR1
Gene Description GDNF family receptor alpha 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,IF
Immunogen Prot. Seq ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GFRA1 (NP_005255, 32 a.a. ~ 119 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2674
Clone Number 4G3
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a full length recombinant GFRA1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a full length recombinant GFRA1.

Mouse monoclonal antibody raised against a full length recombinant GFRA1.