GAMT monoclonal antibody (M04), clone 3H4
  • GAMT monoclonal antibody (M04), clone 3H4

GAMT monoclonal antibody (M04), clone 3H4

Ref: AB-H00002593-M04
GAMT monoclonal antibody (M04), clone 3H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GAMT.
Información adicional
Size 100 ug
Gene Name GAMT
Gene Alias PIG2|TP53I2
Gene Description guanidinoacetate N-methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq PLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GAMT (NP_000147.1, 138 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2593
Clone Number 3H4
Iso type IgG2a Kappa

Enviar un mensaje


GAMT monoclonal antibody (M04), clone 3H4

GAMT monoclonal antibody (M04), clone 3H4