GAMT monoclonal antibody (M04), clone 3H4 View larger

Mouse monoclonal antibody raised against a partial recombinant GAMT.

AB-H00002593-M04

New product

GAMT monoclonal antibody (M04), clone 3H4

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name GAMT
Gene Alias PIG2|TP53I2
Gene Description guanidinoacetate N-methyltransferase
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq PLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GAMT (NP_000147.1, 138 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2593
Clone Number 3H4
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant GAMT.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant GAMT.

Mouse monoclonal antibody raised against a partial recombinant GAMT.