GALNT1 monoclonal antibody (M10), clone 3C10 Ver mas grande

GALNT1 monoclonal antibody (M10), clone 3C10

AB-H00002589-M10

Producto nuevo

GALNT1 monoclonal antibody (M10), clone 3C10

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name GALNT1
Gene Alias GALNAC-T1
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq LPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GALNT1 (NP_065207, 42 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2589
Clone Number 3C10
Iso type IgG2a Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant GALNT1.

Consulta sobre un producto

GALNT1 monoclonal antibody (M10), clone 3C10

GALNT1 monoclonal antibody (M10), clone 3C10