GALNT1 monoclonal antibody (M10), clone 3C10
  • GALNT1 monoclonal antibody (M10), clone 3C10

GALNT1 monoclonal antibody (M10), clone 3C10

Ref: AB-H00002589-M10
GALNT1 monoclonal antibody (M10), clone 3C10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GALNT1.
Información adicional
Size 100 ug
Gene Name GALNT1
Gene Alias GALNAC-T1
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq LPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GALNT1 (NP_065207, 42 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2589
Clone Number 3C10
Iso type IgG2a Kappa

Enviar uma mensagem


GALNT1 monoclonal antibody (M10), clone 3C10

GALNT1 monoclonal antibody (M10), clone 3C10