GALNT1 monoclonal antibody (M10), clone 3C10 View larger

Mouse monoclonal antibody raised against a partial recombinant GALNT1.

AB-H00002589-M10

New product

GALNT1 monoclonal antibody (M10), clone 3C10

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name GALNT1
Gene Alias GALNAC-T1
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq LPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GALNT1 (NP_065207, 42 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2589
Clone Number 3C10
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant GALNT1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant GALNT1.

Mouse monoclonal antibody raised against a partial recombinant GALNT1.