FPR2 monoclonal antibody (M04), clone 2H7 Ver mas grande

FPR2 monoclonal antibody (M04), clone 2H7

AB-H00002358-M04

Producto nuevo

FPR2 monoclonal antibody (M04), clone 2H7

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name FPR2
Gene Alias ALXR|FMLP-R-II|FMLPX|FPR2A|FPRH1|FPRH2|FPRL1|HM63|LXA4R
Gene Description formyl peptide receptor 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FPR2 (AAH29125.1, 163 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2358
Clone Number 2H7
Iso type IgG2a Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant FPR2.

Consulta sobre un producto

FPR2 monoclonal antibody (M04), clone 2H7

FPR2 monoclonal antibody (M04), clone 2H7