FPR2 monoclonal antibody (M04), clone 2H7 View larger

Mouse monoclonal antibody raised against a partial recombinant FPR2.

AB-H00002358-M04

New product

FPR2 monoclonal antibody (M04), clone 2H7

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name FPR2
Gene Alias ALXR|FMLP-R-II|FMLPX|FPR2A|FPRH1|FPRH2|FPRL1|HM63|LXA4R
Gene Description formyl peptide receptor 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FPR2 (AAH29125.1, 163 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2358
Clone Number 2H7
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant FPR2.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant FPR2.

Mouse monoclonal antibody raised against a partial recombinant FPR2.