Ver mas grande
FABP1 monoclonal antibody (M03), clone 6E8
AB-H00002168-M03
Producto nuevo
FABP1 monoclonal antibody (M03), clone 6E8
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | FABP1 |
| Gene Alias | FABPL|L-FABP |
| Gene Description | fatty acid binding protein 1, liver |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | FABP1 (AAH32801, 1 a.a. ~ 127 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 2168 |
| Clone Number | 6E8 |
| Iso type | IgG2b Kappa |
Más información
Mouse monoclonal antibody raised against a full-length recombinant FABP1.