FABP1 monoclonal antibody (M03), clone 6E8 View larger

Mouse monoclonal antibody raised against a full-length recombinant FABP1.

AB-H00002168-M03

New product

FABP1 monoclonal antibody (M03), clone 6E8

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name FABP1
Gene Alias FABPL|L-FABP
Gene Description fatty acid binding protein 1, liver
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FABP1 (AAH32801, 1 a.a. ~ 127 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2168
Clone Number 6E8
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a full-length recombinant FABP1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a full-length recombinant FABP1.

Mouse monoclonal antibody raised against a full-length recombinant FABP1.