ESRRA purified MaxPab rabbit polyclonal antibody (D01P) Ver mas grande

ESRRA purified MaxPab rabbit polyclonal antibody (D01P)

AB-H00002101-D01P

Producto nuevo

ESRRA purified MaxPab rabbit polyclonal antibody (D01P)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name ESRRA
Gene Alias ERR1|ERRa|ERRalpha|ESRL1|NR3B1
Gene Description estrogen-related receptor alpha
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPGFSSLSLS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ESRRA (NP_004442.3, 1 a.a. ~ 423 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2101

Más información

Rabbit polyclonal antibody raised against a full-length human ESRRA protein.

Consulta sobre un producto

ESRRA purified MaxPab rabbit polyclonal antibody (D01P)

ESRRA purified MaxPab rabbit polyclonal antibody (D01P)