ESRRA purified MaxPab rabbit polyclonal antibody (D01P) View larger

Rabbit polyclonal antibody raised against a full-length human ESRRA protein.

AB-H00002101-D01P

New product

ESRRA purified MaxPab rabbit polyclonal antibody (D01P)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name ESRRA
Gene Alias ERR1|ERRa|ERRalpha|ESRL1|NR3B1
Gene Description estrogen-related receptor alpha
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPGFSSLSLS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ESRRA (NP_004442.3, 1 a.a. ~ 423 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2101

More info

Rabbit polyclonal antibody raised against a full-length human ESRRA protein.

Enviar uma mensagem

Rabbit polyclonal antibody raised against a full-length human ESRRA protein.

Rabbit polyclonal antibody raised against a full-length human ESRRA protein.