ESRRA purified MaxPab rabbit polyclonal antibody (D01P)
  • ESRRA purified MaxPab rabbit polyclonal antibody (D01P)

ESRRA purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002101-D01P
ESRRA purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ESRRA protein.
Información adicional
Size 100 ug
Gene Name ESRRA
Gene Alias ERR1|ERRa|ERRalpha|ESRL1|NR3B1
Gene Description estrogen-related receptor alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPGFSSLSLS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ESRRA (NP_004442.3, 1 a.a. ~ 423 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2101

Enviar uma mensagem


ESRRA purified MaxPab rabbit polyclonal antibody (D01P)

ESRRA purified MaxPab rabbit polyclonal antibody (D01P)