Ver mas grande
DIAPH1 monoclonal antibody (M01), clone 5A8
AB-H00001729-M01
Producto nuevo
DIAPH1 monoclonal antibody (M01), clone 5A8
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | DIAPH1 |
| Gene Alias | DFNA1|DIA1|DRF1|FLJ25265|LFHL1|hDIA1 |
| Gene Description | diaphanous homolog 1 (Drosophila) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | QFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKAS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | DIAPH1 (NP_005210, 921 a.a. ~ 1024 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 1729 |
| Clone Number | 5A8 |
| Iso type | IgG2b Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant DIAPH1.