DIAPH1 monoclonal antibody (M01), clone 5A8
  • DIAPH1 monoclonal antibody (M01), clone 5A8

DIAPH1 monoclonal antibody (M01), clone 5A8

Ref: AB-H00001729-M01
DIAPH1 monoclonal antibody (M01), clone 5A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DIAPH1.
Información adicional
Size 100 ug
Gene Name DIAPH1
Gene Alias DFNA1|DIA1|DRF1|FLJ25265|LFHL1|hDIA1
Gene Description diaphanous homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DIAPH1 (NP_005210, 921 a.a. ~ 1024 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1729
Clone Number 5A8
Iso type IgG2b Kappa

Enviar uma mensagem


DIAPH1 monoclonal antibody (M01), clone 5A8

DIAPH1 monoclonal antibody (M01), clone 5A8