Ver mas grande
CLTA monoclonal antibody (M08), clone 4E9
AB-H00001211-M08
Producto nuevo
CLTA monoclonal antibody (M08), clone 4E9
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CLTA |
| Gene Alias | LCA |
| Gene Description | clathrin, light chain (Lca) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CLTA (NP_001824.1, 118 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 1211 |
| Clone Number | 4E9 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant CLTA.