CLTA monoclonal antibody (M08), clone 4E9
  • CLTA monoclonal antibody (M08), clone 4E9

CLTA monoclonal antibody (M08), clone 4E9

Ref: AB-H00001211-M08
CLTA monoclonal antibody (M08), clone 4E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CLTA.
Información adicional
Size 100 ug
Gene Name CLTA
Gene Alias LCA
Gene Description clathrin, light chain (Lca)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLTA (NP_001824.1, 118 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1211
Clone Number 4E9
Iso type IgG2a Kappa

Enviar uma mensagem


CLTA monoclonal antibody (M08), clone 4E9

CLTA monoclonal antibody (M08), clone 4E9