CCNH purified MaxPab mouse polyclonal antibody (B01P) Ver mas grande

CCNH purified MaxPab mouse polyclonal antibody (B01P)

AB-H00000902-B01P

Producto nuevo

CCNH purified MaxPab mouse polyclonal antibody (B01P)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 50 ug
Gene Name CCNH
Gene Alias CAK|p34|p37
Gene Description cyclin H
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCNH (NP_001230.1, 1 a.a. ~ 323 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 902

Más información

Mouse polyclonal antibody raised against a full-length human CCNH protein.

Consulta sobre un producto

CCNH purified MaxPab mouse polyclonal antibody (B01P)

CCNH purified MaxPab mouse polyclonal antibody (B01P)