CCNH purified MaxPab mouse polyclonal antibody (B01P)
  • CCNH purified MaxPab mouse polyclonal antibody (B01P)

CCNH purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000902-B01P
CCNH purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CCNH protein.
Información adicional
Size 50 ug
Gene Name CCNH
Gene Alias CAK|p34|p37
Gene Description cyclin H
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCNH (NP_001230.1, 1 a.a. ~ 323 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 902

Enviar uma mensagem


CCNH purified MaxPab mouse polyclonal antibody (B01P)

CCNH purified MaxPab mouse polyclonal antibody (B01P)