Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
CASP7 MaxPab rabbit polyclonal antibody (D01)
Abnova
CASP7 MaxPab rabbit polyclonal antibody (D01)
Ref: AB-H00000840-D01
CASP7 MaxPab rabbit polyclonal antibody (D01)
Contáctenos
Información del producto
Rabbit polyclonal antibody raised against a full-length human CASP7 protein.
Información adicional
Size
100 uL
Gene Name
CASP7
Gene Alias
CMH-1|ICE-LAP3|MCH3
Gene Description
caspase 7, apoptosis-related cysteine peptidase
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,IP
Immunogen Prot. Seq
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKD
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
CASP7 (NP_001218.1, 1 a.a. ~ 303 a.a) full-length human protein.
Storage Buffer
No additive
Gene ID
840
Enviar un mensaje
CASP7 MaxPab rabbit polyclonal antibody (D01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*