CASP7 MaxPab rabbit polyclonal antibody (D01)
  • CASP7 MaxPab rabbit polyclonal antibody (D01)

CASP7 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00000840-D01
CASP7 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CASP7 protein.
Información adicional
Size 100 uL
Gene Name CASP7
Gene Alias CMH-1|ICE-LAP3|MCH3
Gene Description caspase 7, apoptosis-related cysteine peptidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CASP7 (NP_001218.1, 1 a.a. ~ 303 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 840

Enviar uma mensagem


CASP7 MaxPab rabbit polyclonal antibody (D01)

CASP7 MaxPab rabbit polyclonal antibody (D01)