Ver mas grande
C1QBP purified MaxPab mouse polyclonal antibody (B01P)
AB-H00000708-B01P
Producto nuevo
C1QBP purified MaxPab mouse polyclonal antibody (B01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | C1QBP |
| Gene Alias | GC1QBP|HABP1|SF2p32|gC1Q-R|gC1qR|p32 |
| Gene Description | complement component 1, q subcomponent binding protein |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Ce,WB-Tr,IF |
| Immunogen Prot. Seq | MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADE |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | C1QBP (NP_001203.1, 1 a.a. ~ 282 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 708 |
Más información
Mouse polyclonal antibody raised against a full-length human C1QBP protein.