C1QBP purified MaxPab mouse polyclonal antibody (B01P) View larger

Mouse polyclonal antibody raised against a full-length human C1QBP protein.

AB-H00000708-B01P

New product

C1QBP purified MaxPab mouse polyclonal antibody (B01P)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 ug
Gene Name C1QBP
Gene Alias GC1QBP|HABP1|SF2p32|gC1Q-R|gC1qR|p32
Gene Description complement component 1, q subcomponent binding protein
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C1QBP (NP_001203.1, 1 a.a. ~ 282 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 708

More info

Mouse polyclonal antibody raised against a full-length human C1QBP protein.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length human C1QBP protein.

Mouse polyclonal antibody raised against a full-length human C1QBP protein.