Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
KLF9 monoclonal antibody (M02), clone 2B9
Abnova
KLF9 monoclonal antibody (M02), clone 2B9
Ref: AB-H00000687-M02
KLF9 monoclonal antibody (M02), clone 2B9
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant KLF9.
Información adicional
Size
100 ug
Gene Name
KLF9
Gene Alias
BTEB|BTEB1
Gene Description
Kruppel-like factor 9
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
S-ELISA,ELISA
Immunogen Prot. Seq
PEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTT
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
KLF9 (NP_001197, 25 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
687
Clone Number
2B9
Iso type
IgG2a Kappa
Enviar un mensaje
KLF9 monoclonal antibody (M02), clone 2B9
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*