Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
KLF9 monoclonal antibody (M02), clone 2B9
Abnova
KLF9 monoclonal antibody (M02), clone 2B9
Ref: AB-H00000687-M02
KLF9 monoclonal antibody (M02), clone 2B9
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant KLF9.
Información adicional
Size
100 ug
Gene Name
KLF9
Gene Alias
BTEB|BTEB1
Gene Description
Kruppel-like factor 9
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
S-ELISA,ELISA
Immunogen Prot. Seq
PEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTT
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
KLF9 (NP_001197, 25 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
687
Clone Number
2B9
Iso type
IgG2a Kappa
Enviar uma mensagem
KLF9 monoclonal antibody (M02), clone 2B9
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*