Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ASGR1 monoclonal antibody (M03), clone 1G4
Abnova
ASGR1 monoclonal antibody (M03), clone 1G4
Ref: AB-H00000432-M03
ASGR1 monoclonal antibody (M03), clone 1G4
Contáctenos
Información del producto
Mouse monoclonal antibody raised against human ASGR1.
Información adicional
Size
100 ug
Gene Name
ASGR1
Gene Alias
HL-1|ASGPR|ASGPR1|CLEC4H1
Gene Description
asialoglycoprotein receptor 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Ce,ELISA
Immunogen Prot. Seq
GRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGC
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
A synthetic peptide corresponding to human ASGR1
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
432
Clone Number
1G4
Iso type
IgG1 Kappa
Enviar un mensaje
ASGR1 monoclonal antibody (M03), clone 1G4
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*