Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ASGR1 monoclonal antibody (M03), clone 1G4
Abnova
ASGR1 monoclonal antibody (M03), clone 1G4
Ref: AB-H00000432-M03
ASGR1 monoclonal antibody (M03), clone 1G4
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against human ASGR1.
Información adicional
Size
100 ug
Gene Name
ASGR1
Gene Alias
HL-1|ASGPR|ASGPR1|CLEC4H1
Gene Description
asialoglycoprotein receptor 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Ce,ELISA
Immunogen Prot. Seq
GRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGC
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
A synthetic peptide corresponding to human ASGR1
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
432
Clone Number
1G4
Iso type
IgG1 Kappa
Enviar uma mensagem
ASGR1 monoclonal antibody (M03), clone 1G4
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*