ARHGDIG monoclonal antibody (M01), clone 1D11
  • ARHGDIG monoclonal antibody (M01), clone 1D11

ARHGDIG monoclonal antibody (M01), clone 1D11

Ref: AB-H00000398-M01
ARHGDIG monoclonal antibody (M01), clone 1D11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ARHGDIG.
Información adicional
Size 100 ug
Gene Name ARHGDIG
Gene Alias RHOGDI-3
Gene Description Rho GDP dissociation inhibitor (GDI) gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARHGDIG (AAH47699, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 398
Clone Number 1D11
Iso type IgG2a Kappa

Enviar un mensaje


ARHGDIG monoclonal antibody (M01), clone 1D11

ARHGDIG monoclonal antibody (M01), clone 1D11