ARHGDIG monoclonal antibody (M01), clone 1D11 View larger

Mouse monoclonal antibody raised against a full length recombinant ARHGDIG.

AB-H00000398-M01

New product

ARHGDIG monoclonal antibody (M01), clone 1D11

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name ARHGDIG
Gene Alias RHOGDI-3
Gene Description Rho GDP dissociation inhibitor (GDI) gamma
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARHGDIG (AAH47699, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 398
Clone Number 1D11
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a full length recombinant ARHGDIG.

Enviar uma mensagem

Mouse monoclonal antibody raised against a full length recombinant ARHGDIG.

Mouse monoclonal antibody raised against a full length recombinant ARHGDIG.