Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ARHGDIG monoclonal antibody (M01), clone 1D11
Abnova
ARHGDIG monoclonal antibody (M01), clone 1D11
Ref: AB-H00000398-M01
ARHGDIG monoclonal antibody (M01), clone 1D11
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a full length recombinant ARHGDIG.
Información adicional
Size
100 ug
Gene Name
ARHGDIG
Gene Alias
RHOGDI-3
Gene Description
Rho GDP dissociation inhibitor (GDI) gamma
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ARHGDIG (AAH47699, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
398
Clone Number
1D11
Iso type
IgG2a Kappa
Enviar uma mensagem
ARHGDIG monoclonal antibody (M01), clone 1D11
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*