AREG monoclonal antibody (M06), clone 3E4
  • AREG monoclonal antibody (M06), clone 3E4

AREG monoclonal antibody (M06), clone 3E4

Ref: AB-H00000374-M06
AREG monoclonal antibody (M06), clone 3E4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AREG.
Información adicional
Size 100 ug
Gene Name AREG
Gene Alias AR|CRDGF|MGC13647|SDGF
Gene Description amphiregulin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq SGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AREG (AAH09799, 20 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 374
Clone Number 3E4
Iso type IgG2b Kappa

Enviar un mensaje


AREG monoclonal antibody (M06), clone 3E4

AREG monoclonal antibody (M06), clone 3E4