AREG monoclonal antibody (M06), clone 3E4 View larger

Mouse monoclonal antibody raised against a partial recombinant AREG.

AB-H00000374-M06

New product

AREG monoclonal antibody (M06), clone 3E4

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name AREG
Gene Alias AR|CRDGF|MGC13647|SDGF
Gene Description amphiregulin
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq SGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AREG (AAH09799, 20 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 374
Clone Number 3E4
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant AREG.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant AREG.

Mouse monoclonal antibody raised against a partial recombinant AREG.