TRIM23 monoclonal antibody (M01), clone 2H4
  • TRIM23 monoclonal antibody (M01), clone 2H4

TRIM23 monoclonal antibody (M01), clone 2H4

Ref: AB-H00000373-M01
TRIM23 monoclonal antibody (M01), clone 2H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRIM23.
Información adicional
Size 100 ug
Gene Name TRIM23
Gene Alias ARD1|ARFD1|RNF46
Gene Description tripartite motif-containing 23
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MATLVVNKLGAGVDSGRQGSRGTAVVKVLECGVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAIRCPFDRQVTDLGDSGVWGLKKNFALLELLERLQNGPIGQY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM23 (AAH22510, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 373
Clone Number 2H4
Iso type IgG2b Kappa

Enviar un mensaje


TRIM23 monoclonal antibody (M01), clone 2H4

TRIM23 monoclonal antibody (M01), clone 2H4