Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
TRIM23 monoclonal antibody (M01), clone 2H4
Abnova
TRIM23 monoclonal antibody (M01), clone 2H4
Ref: AB-H00000373-M01
TRIM23 monoclonal antibody (M01), clone 2H4
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant TRIM23.
Información adicional
Size
100 ug
Gene Name
TRIM23
Gene Alias
ARD1|ARFD1|RNF46
Gene Description
tripartite motif-containing 23
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
MATLVVNKLGAGVDSGRQGSRGTAVVKVLECGVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAIRCPFDRQVTDLGDSGVWGLKKNFALLELLERLQNGPIGQY
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
TRIM23 (AAH22510, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
373
Clone Number
2H4
Iso type
IgG2b Kappa
Enviar uma mensagem
TRIM23 monoclonal antibody (M01), clone 2H4
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*