ARAF monoclonal antibody (M02), clone 5H8
  • ARAF monoclonal antibody (M02), clone 5H8

ARAF monoclonal antibody (M02), clone 5H8

Ref: AB-H00000369-M02
ARAF monoclonal antibody (M02), clone 5H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ARAF.
Información adicional
Size 100 ug
Gene Name ARAF
Gene Alias A-RAF|ARAF1|PKS2|RAFA1
Gene Description v-raf murine sarcoma 3611 viral oncogene homolog
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARAF (NP_001645, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 369
Clone Number 5H8
Iso type IgG2a Kappa

Enviar un mensaje


ARAF monoclonal antibody (M02), clone 5H8

ARAF monoclonal antibody (M02), clone 5H8