Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ARAF monoclonal antibody (M02), clone 5H8
Abnova
ARAF monoclonal antibody (M02), clone 5H8
Ref: AB-H00000369-M02
ARAF monoclonal antibody (M02), clone 5H8
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ARAF.
Información adicional
Size
100 ug
Gene Name
ARAF
Gene Alias
A-RAF|ARAF1|PKS2|RAFA1
Gene Description
v-raf murine sarcoma 3611 viral oncogene homolog
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
RQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGS
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ARAF (NP_001645, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
369
Clone Number
5H8
Iso type
IgG2a Kappa
Enviar uma mensagem
ARAF monoclonal antibody (M02), clone 5H8
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*