APBB2 monoclonal antibody (M01), clone 2D8 Ver mas grande

APBB2 monoclonal antibody (M01), clone 2D8

AB-H00000323-M01

Producto nuevo

APBB2 monoclonal antibody (M01), clone 2D8

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name APBB2
Gene Alias DKFZp434E033|FE65L|FE65L1|MGC35575
Gene Description amyloid beta (A4) precursor protein-binding, family B, member 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen APBB2 (AAH27946, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 323
Clone Number 2D8
Iso type IgG1 kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant APBB2.

Consulta sobre un producto

APBB2 monoclonal antibody (M01), clone 2D8

APBB2 monoclonal antibody (M01), clone 2D8