Ver mas grande
APBB2 monoclonal antibody (M01), clone 2D8
AB-H00000323-M01
Producto nuevo
APBB2 monoclonal antibody (M01), clone 2D8
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | APBB2 |
| Gene Alias | DKFZp434E033|FE65L|FE65L1|MGC35575 |
| Gene Description | amyloid beta (A4) precursor protein-binding, family B, member 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLV |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | APBB2 (AAH27946, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 323 |
| Clone Number | 2D8 |
| Iso type | IgG1 kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant APBB2.