APBB2 monoclonal antibody (M01), clone 2D8 View larger

Mouse monoclonal antibody raised against a partial recombinant APBB2.

AB-H00000323-M01

New product

APBB2 monoclonal antibody (M01), clone 2D8

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name APBB2
Gene Alias DKFZp434E033|FE65L|FE65L1|MGC35575
Gene Description amyloid beta (A4) precursor protein-binding, family B, member 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen APBB2 (AAH27946, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 323
Clone Number 2D8
Iso type IgG1 kappa

More info

Mouse monoclonal antibody raised against a partial recombinant APBB2.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant APBB2.

Mouse monoclonal antibody raised against a partial recombinant APBB2.