Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
APBB2 monoclonal antibody (M01), clone 2D8
Abnova
APBB2 monoclonal antibody (M01), clone 2D8
Ref: AB-H00000323-M01
APBB2 monoclonal antibody (M01), clone 2D8
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant APBB2.
Información adicional
Size
100 ug
Gene Name
APBB2
Gene Alias
DKFZp434E033|FE65L|FE65L1|MGC35575
Gene Description
amyloid beta (A4) precursor protein-binding, family B, member 2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLV
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
APBB2 (AAH27946, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
323
Clone Number
2D8
Iso type
IgG1 kappa
Enviar uma mensagem
APBB2 monoclonal antibody (M01), clone 2D8
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*