Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ALPPL2 polyclonal antibody (A01)
Abnova
ALPPL2 polyclonal antibody (A01)
Ref: AB-H00000251-A01
ALPPL2 polyclonal antibody (A01)
Contáctenos
Información del producto
Mouse polyclonal antibody raised against a partial recombinant ALPPL2.
Información adicional
Size
50 uL
Gene Name
ALPPL2
Gene Alias
ALPG|ALPPL|GCAP
Gene Description
alkaline phosphatase, placental-like 2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ALPPL2 (NP_112603, 365 a.a. ~ 454 a.a) partial recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
251
Enviar un mensaje
ALPPL2 polyclonal antibody (A01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*