ALPPL2 polyclonal antibody (A01)
  • ALPPL2 polyclonal antibody (A01)

ALPPL2 polyclonal antibody (A01)

Ref: AB-H00000251-A01
ALPPL2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ALPPL2.
Información adicional
Size 50 uL
Gene Name ALPPL2
Gene Alias ALPG|ALPPL|GCAP
Gene Description alkaline phosphatase, placental-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ALPPL2 (NP_112603, 365 a.a. ~ 454 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 251

Enviar uma mensagem


ALPPL2 polyclonal antibody (A01)

ALPPL2 polyclonal antibody (A01)