Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ALDH2 monoclonal antibody (M01), clone 1E5
Abnova
ALDH2 monoclonal antibody (M01), clone 1E5
Ref: AB-H00000217-M01
ALDH2 monoclonal antibody (M01), clone 1E5
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ALDH2.
Información adicional
Size
100 ug
Gene Name
ALDH2
Gene Alias
ALDH-E2|ALDHI|ALDM|MGC1806
Gene Description
aldehyde dehydrogenase 2 family (mitochondrial)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ALDH2 (AAH02967, 408 a.a. ~ 517 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
217
Clone Number
1E5
Iso type
IgG2a Kappa
Enviar un mensaje
ALDH2 monoclonal antibody (M01), clone 1E5
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*