Ver mas grande
ALDH2 monoclonal antibody (M01), clone 1E5
AB-H00000217-M01
Producto nuevo
ALDH2 monoclonal antibody (M01), clone 1E5
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | ALDH2 |
| Gene Alias | ALDH-E2|ALDHI|ALDM|MGC1806 |
| Gene Description | aldehyde dehydrogenase 2 family (mitochondrial) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | ALDH2 (AAH02967, 408 a.a. ~ 517 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 217 |
| Clone Number | 1E5 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant ALDH2.