ALDH2 monoclonal antibody (M01), clone 1E5
  • ALDH2 monoclonal antibody (M01), clone 1E5

ALDH2 monoclonal antibody (M01), clone 1E5

Ref: AB-H00000217-M01
ALDH2 monoclonal antibody (M01), clone 1E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ALDH2.
Información adicional
Size 100 ug
Gene Name ALDH2
Gene Alias ALDH-E2|ALDHI|ALDM|MGC1806
Gene Description aldehyde dehydrogenase 2 family (mitochondrial)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ALDH2 (AAH02967, 408 a.a. ~ 517 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 217
Clone Number 1E5
Iso type IgG2a Kappa

Enviar un mensaje


ALDH2 monoclonal antibody (M01), clone 1E5

ALDH2 monoclonal antibody (M01), clone 1E5