Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ALDH2 monoclonal antibody (M01), clone 1E5
Abnova
ALDH2 monoclonal antibody (M01), clone 1E5
Ref: AB-H00000217-M01
ALDH2 monoclonal antibody (M01), clone 1E5
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ALDH2.
Información adicional
Size
100 ug
Gene Name
ALDH2
Gene Alias
ALDH-E2|ALDHI|ALDM|MGC1806
Gene Description
aldehyde dehydrogenase 2 family (mitochondrial)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ALDH2 (AAH02967, 408 a.a. ~ 517 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
217
Clone Number
1E5
Iso type
IgG2a Kappa
Enviar uma mensagem
ALDH2 monoclonal antibody (M01), clone 1E5
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*