ACVR1B polyclonal antibody (A01)
  • ACVR1B polyclonal antibody (A01)

ACVR1B polyclonal antibody (A01)

Ref: AB-H00000091-A01
ACVR1B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ACVR1B.
Información adicional
Size 50 uL
Gene Name ACVR1B
Gene Alias ACTRIB|ACVRLK4|ALK4|SKR2
Gene Description activin A receptor, type IB
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACVR1B (AAH00254, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 91

Enviar un mensaje


ACVR1B polyclonal antibody (A01)

ACVR1B polyclonal antibody (A01)