Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ACVR1B polyclonal antibody (A01)
Abnova
ACVR1B polyclonal antibody (A01)
Ref: AB-H00000091-A01
ACVR1B polyclonal antibody (A01)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a partial recombinant ACVR1B.
Información adicional
Size
50 uL
Gene Name
ACVR1B
Gene Alias
ACTRIB|ACVRLK4|ALK4|SKR2
Gene Description
activin A receptor, type IB
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ACVR1B (AAH00254, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
91
Enviar uma mensagem
ACVR1B polyclonal antibody (A01)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*