ACTN4 monoclonal antibody (M02), clone 1E10
  • ACTN4 monoclonal antibody (M02), clone 1E10

ACTN4 monoclonal antibody (M02), clone 1E10

Ref: AB-H00000081-M02
ACTN4 monoclonal antibody (M02), clone 1E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ACTN4.
Información adicional
Size 100 ug
Gene Name ACTN4
Gene Alias ACTININ-4|DKFZp686K23158|FSGS|FSGS1
Gene Description actinin, alpha 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACTN4 (NP_004915, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 81
Clone Number 1E10
Iso type IgG2a

Enviar un mensaje


ACTN4 monoclonal antibody (M02), clone 1E10

ACTN4 monoclonal antibody (M02), clone 1E10