View larger
Mouse monoclonal antibody raised against a partial recombinant ACTN4.
AB-H00000081-M02
New product
ACTN4 monoclonal antibody (M02), clone 1E10
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | ACTN4 |
| Gene Alias | ACTININ-4|DKFZp686K23158|FSGS|FSGS1 |
| Gene Description | actinin, alpha 4 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | ACTN4 (NP_004915, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 81 |
| Clone Number | 1E10 |
| Iso type | IgG2a |
More info
Mouse monoclonal antibody raised against a partial recombinant ACTN4.